Human KITLG protein

Catalog Number: orb246378

Catalog Number	orb246378
Category	Proteins
Description	Recombinant human Kit ligand
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	45.5 kDa
UniProt ID	P21583
Protein Sequence	EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Protein Length	Partial
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	26-189aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	KITLG Read more...
Note	For research use only
Application notes	Partial of Soluble KIT ligand chain of GST-tag and expression region is 26-189aa
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	19.5 kDa
Source:	Mouse SCF, His Tag (orb257825) is expressed from human 293 cells (HEK293). It contains AA Lys 26 - Ala 189 (Accession # NP_038626).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli