You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494959 |
---|---|
Category | Proteins |
Description | IP-10 was originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8.5 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP |
Source | Escherichia coli. |
Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg. |
Endotoxins | Less than 1EU/mg of rHuIP-10/CXCL10 as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating