Human interleukin 1β

• Catalog Number: orb1729593
• Category: Proteins
• Description: This protein is produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature human IL-1 beta shares > 80 % aa sequence identity with mouse IL-1 beta
• Species/Host: E. coli
• Tested applications: SDS-PAGE
• Reactivity: Human, Mouse
• Tag: Histidine
• Concentration: 1mg/mL
• Dilution range: NA
• Form/Appearance: Lyophilized
• Purity: ≥98%
• Conjugation: Unconjugated
• MW: ~17 kDa
• Hazard Information: For Research use only
• Solubility (25°C): Soluble in PBS at 25°C
• Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Source: E.coli
• Expression System: Intercellular
• Biological Origin: Recombinant protein expressed as His tage protein in E.coli
• Endotoxins: Not tested
• Storage: After reconstitution, store at -20°C; Avoid repeated freeze thaw
• Buffer/Preservatives: No preservative
• Alternative names: IL1B, IL1F2
• Note: For research use only
• Application notes: For research use only
• Expiration Date: 6 months from date of receipt.