You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1729593 |
---|---|
Category | Proteins |
Description | This protein is produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature human IL-1 beta shares > 80 % aa sequence identity with mouse IL-1 beta |
Species/Host | E. coli |
Tested applications | SDS-PAGE |
Reactivity | Human, Mouse |
Tag | Histidine |
Concentration | 1mg/mL |
Dilution range | NA |
Form/Appearance | Lyophilized |
Purity | ≥98% |
Conjugation | Unconjugated |
MW | ~17 kDa |
Hazard Information | For Research use only |
Solubility (25°C) | Soluble in PBS at 25°C |
Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Source | E.coli |
Expression System | Intercellular |
Biological Origin | Recombinant protein expressed as His tage protein in E.coli |
Endotoxins | Not tested |
Storage | After reconstitution, store at -20°C; Avoid repeated freeze thaw |
Buffer/Preservatives | No preservative |
Alternative names | IL1B, IL1F2 Read more... |
Note | For research use only |
Application notes | For research use only |
Expiration Date | 6 months from date of receipt. |
Human | |
7.8 pg/ml - 500 pg/ml | |
1.95 pg/ml |
Human | |
7.82-500 pg/mL | |
3.1 pg/mL |
Human | |
7.82-500pg/mL | |
4.69 pg/mL |
Human | |
2.344 pg/ml-150 pg/ml | |
0.586 pg/ml |
Filter by Rating