You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb8257 |
---|---|
Category | Proteins |
Description | Recombinant of human INSR protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 47.2 kDa |
UniProt ID | P06213 |
Protein Sequence | ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1023-1298aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CD_antigen, CD220 Read more... |
Note | For research use only |
Application notes | Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1023-1298aaSequence Info: PartialGlycerol content: 0.5 |
Expiration Date | 6 months from date of receipt. |
≥90% as determined by SDS-PAGE | |
This protein contains the human INSR(Met1-Ser758) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
51.8 kDa | |
E.Coli |
Unconjugated | |
90% | |
83.6 kDa and 22.8 kDa | |
Human Insulin R (28-944), His Tag (orb545724) is expressed from human 293 cells (HEK293). It contains AA His 28 - Lys 944 (Accession # P06213-2). |
Filter by Rating