You have no items in your shopping cart.
Cart summary
Human ILDR2 protein
Catalog Number: orb246173
| Catalog Number | orb246173 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Immunoglobulin-like domain-containing receptor 2 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 23.1 kDa |
| UniProt ID | Q71H61 |
| Protein Sequence | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-186aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | ILDR2 Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human ILDR2 full length protein-synthetic nanodisc [orb1826532]
The human full length ILDR2 protein has a MW of 71.2 kDa
Mammalian
100 μg, 10 μg, 50 μg Human ILDR2 protein [orb244862]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μg, 100 μg, 1 mgHuman ILDR2-Strep full length protein-synthetic nanodisc [orb2668924]
The human full length ILDR2-Strep protein has a MW of 71.2 kDa
100 μg, 50 μg, 10 μgILDR2 Protein, Human, Recombinant (His) [orb1961895]
98.00%
45-55 KDa (reducing condition)
50 μg, 500 μg, 1 mg, 10 μg
