You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54713 |
---|---|
Category | Proteins |
Description | Recombinant human IL7 protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 33.4 kDa |
UniProt ID | P13232 |
Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Protein Length | Full Length of Mature Protein |
Source | in vitro E.coli expression system |
Biological Origin | Homo sapiens (Human) |
Expression Region | 26-177aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | IL 7, IL-7, Il7, IL7_HUMAN, Interleukin 7, Interle Read more... |
Note | For research use only |
Application notes | N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-246AA: 26-177AAFull Length : Full Length |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
17.4 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
17.5 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
18.4 kDa | |
Mammalian cell |
Unconjugated | |
90% | |
16.8 kDa | |
Mouse IL-7, His Tag (orb1496304) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ile 154 (Accession # Q544C8). |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
17.5 KDa | |
E. Coli |
Filter by Rating