Human IL7 protein

• Catalog Number: orb54713
• Category: Proteins
• Description: Recombinant human IL7 protein
• Tag: N-terminal 6xHis-SUMO-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 33.4 kDa
• UniProt ID: P13232
• Protein Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Protein Length: Full Length of Mature Protein
• Source: in vitro E.coli expression system
• Biological Origin: Homo sapiens (Human)
• Expression Region: 26-177aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: IL 7, IL-7, Il7, IL7_HUMAN, Interleukin 7, Interle
• Note: For research use only
• Application notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-246AA: 26-177AAFull Length : Full Length
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.