You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL6 protein (Active)
Catalog Number: orb358972
| Catalog Number | orb358972 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL6 active protein |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| MW | 20.7 kDa |
| UniProt ID | P05231 |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM |
| Protein Length | Full Length of Mature Protein |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 ×106 IU/mg. |
| Expression Region | 30-212aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Alternative names | Interleukin BSF 2 protein, B cell differentiation Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human IL6 protein [orb594784]
Greater than 95% as determined by SDS-PAGE.
20.9 kDa
E.coli
1 mg, 500 μg, 50 μg, 10 μg 
Human IL6 protein [orb594722]
Greater than 95% as determined by SDS-PAGE.
79.7 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg- Item 1 of 1
Recombinant human OSM protein (Active, HEK293) [orb1817194]
> 95% as determined by SDS-PAGE
35 kDa
50 μg, 10 μg, 500 μg - Item 1 of 1
Recombinant human IL-6 protein (Active, HEK293) [orb1817202]
> 95% as determined by SDS-PAGE
26-30 kDa
50 μg, 10 μg, 500 μg Recombinant Human Interleukin-6 protein(IL6) (Active) [orb1650622]
5 μg, 20 μg, 100 μg, 250 μg, 1 mg, 500 μg
