You have no items in your shopping cart.
Cart summary
Human IL4R protein
Catalog Number: orb594781
| Catalog Number | orb594781 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 24.4 kDa |
| UniProt ID | P24394 |
| Protein Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml. |
| Expression Region | 26-232aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | Interleukin-4 receptor subunit alpha; IL-4 recepto Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human IL-4 R alpha / CD124 Protein [orb257626]
Unconjugated
95%
24.6 kDa
Human IL-4 R alpha, His Tag (orb257626) is expressed from human 293 cells (HEK293). It contains AA Met 26 - His 232 (Accession # NP_000409.1).
1 mg, 50 μg - Item 1 of 2
Cynomolgus / Rhesus macaque IL-4 R alpha / CD124 Protein [orb257988]
Unconjugated
95%
25.6 kDa
Cynomolgus / Rhesus macaque IL-4 R alpha, His Tag (orb257988) is expressed from human 293 cells (HEK293). It contains AA Met 26 - Arg 232 (Accession # G7Q0S7).
1 mg, 50 μg - Item 1 of 2
Cynomolgus / Rhesus macaque IL-4 R alpha / CD124 Protein [orb257987]
Unconjugated
95%
50.4 kDa
Cynomolgus / Rhesus macaque IL-4 R alpha, Fc Tag (orb257987) is expressed from human 293 cells (HEK293). It contains AA Met 26 - Arg 232 (Accession # G7Q0S7).
1 mg, 50 μg - Item 1 of 2
Mouse IL-4 R alpha / CD124 Protein [orb334907]
Unconjugated
95%
51 kDa
Mouse IL-4 R alpha, Fc Tag (orb334907) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700).
100 μg, 1 mg - Item 1 of 2
Mouse IL-4 R alpha / CD124 Protein [orb334908]
Unconjugated
95%
26.3 kDa
Mouse IL-4 R alpha, His Tag (orb334908) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700).
100 μg, 1 mg
