You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594781 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 24.4 kDa |
UniProt ID | P24394 |
Protein Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml. |
Expression Region | 26-232aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Interleukin-4 receptor subunit alpha; IL-4 recepto Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
95% | |
24.6 kDa | |
Human IL-4 R alpha, His Tag (orb257626) is expressed from human 293 cells (HEK293). It contains AA Met 26 - His 232 (Accession # NP_000409.1). |
Unconjugated | |
95% | |
25.6 kDa | |
Cynomolgus / Rhesus macaque IL-4 R alpha, His Tag (orb257988) is expressed from human 293 cells (HEK293). It contains AA Met 26 - Arg 232 (Accession # G7Q0S7). |
Unconjugated | |
95% | |
50.4 kDa | |
Cynomolgus / Rhesus macaque IL-4 R alpha, Fc Tag (orb257987) is expressed from human 293 cells (HEK293). It contains AA Met 26 - Arg 232 (Accession # G7Q0S7). |
Unconjugated | |
95% | |
26.3 kDa | |
Mouse IL-4 R alpha, His Tag (orb334908) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700). |
Unconjugated | |
95% | |
51 kDa | |
Mouse IL-4 R alpha, Fc Tag (orb334907) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700). |