You have no items in your shopping cart.
Cart summary
Human IL36G protein
Catalog Number: orb54523
| Catalog Number | orb54523 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL36G protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 45.7 kDa |
| UniProt ID | Q9NZH8 |
| Protein Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Protein Length | Full Length |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-169aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | IL-1-related protein 2 Read more... |
| Note | For research use only |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-158AA: 1-169AAFull Length : Full Length |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human IL36G protein [orb594810]
Greater than 95% as determined by SDS-PAGE.
17 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL36G protein (Active) [orb358994]
> 95% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
100 μg, 500 μg, 10 μg - Item 1 of 1
Human IL36G protein (Active) [orb358995]
> 95% as determined by SDS-PAGE and HPLC.
17.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL36G Protein, hFc Tag [orb2321300]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.2 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg
