You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246588 |
---|---|
Category | Proteins |
Description | Recombinant human Interleukin-29 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 36 kDa |
UniProt ID | Q8IU54 |
Protein Sequence | PVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 21-200aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | IL29 Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
21.1 kDa | |
Human IL-29, His Tag (orb257605) is expressed from human 293 cells (HEK293). It contains AA Gly 20 - Thr 200 (Accession # NP_742152.1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
21.4 KDa | |
Mammalian |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 97% pure by SDS-PAGE and HPLC analyses. | |
19.8 kDa |
≥90% as determined by SDS-PAGE | |
This protein contains the human IFNL1(Met1-Thr200) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating