You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL29 protein
Catalog Number: orb246588
| Catalog Number | orb246588 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Interleukin-29 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 36 kDa |
| UniProt ID | Q8IU54 |
| Protein Sequence | PVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 21-200aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | IL29 Read more... |
| Note | For research use only |
| Application notes | This is His-SUMO-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL-29 Protein, His Tag [orb257605]
Unconjugated
95%
21.1 kDa
Human IL-29, His Tag (orb257605) is expressed from human 293 cells (HEK293). It contains AA Gly 20 - Thr 200 (Accession # NP_742152.1).
20 μg, 50 μg - Item 1 of 1
Human IL-29 (C-10His) Protein [orb1471744]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
21.4 KDa
Mammalian
50 μg, 10 μg - Item 1 of 1
Human IL29 Protein, hFc Tag [orb2321390]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.2 kDa after removal of the signal peptide. The apparent molecular mass of IL29-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 1
Recombinant human IL-29 protein (Active, HEK293) [orb1817195]
> 95% as determined by SDS-PAGE
29-35 kDa
50 μg, 10 μg, 500 μg 
Human IFNL1 protein [orb706991]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
