Human IL20RA protein

Catalog Number: orb594799

Catalog Number	orb594799
Category	Proteins
Description	Recombinant Human Interleukin-20 receptor subunit alpha(IL20RA),partial (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	26.3 kDa
UniProt ID	Q9UHF4
Protein Sequence	VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.
Expression Region	30-250aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alternative names	Interleukin-20 Receptor Subunit Alpha; IL-20 Recep Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 51.4 kDa after removal of the signal peptide. The apparent molecular mass of IL20RA-hFc is approximately 55-100 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	Human cells