You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594814 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-1 receptor antagonist protein(IL1RN) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 17.26 kDa |
UniProt ID | P18510 |
Protein Sequence | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit IL-1 beta induced NF-kB signaling in 293-IL1 Res cells is 13.2 ng/mL. |
Expression Region | 26-177aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5 |
Alternative names | Interleukin-1 Receptor Antagonist Protein; IL-1RN; Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, FC, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
> 96% as determined by SDS-PAGE and HPLC. | |
17.1 kDa | |
E.Coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 62.3 kDa after removal of the signal peptide.The apparent molecular mass of IL1RA-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 37.5 kDa after removal of the signal peptide. The apparent molecular mass of IL1RA-His is approximately 35-70 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 62.4 kDa after removal of the signal peptide. The apparent molecular mass of IL1RA-mFc is approximately 70-100 kDa due to glycosylation. | |
Mammalian |