You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL1RA protein
Catalog Number: orb594814
| Catalog Number | orb594814 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-1 receptor antagonist protein(IL1RN) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 17.26 kDa |
| UniProt ID | P18510 |
| Protein Sequence | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit IL-1 beta induced NF-kB signaling in 293-IL1 Res cells is 13.2 ng/mL. |
| Expression Region | 26-177aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5 |
| Alternative names | Interleukin-1 Receptor Antagonist Protein; IL-1RN; Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Anti-IL1RA/IL1RN Antibody [orb402389]
ELISA, FC, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μg - Item 1 of 1
Human IL1RA protein (Active) [orb358967]
> 96% as determined by SDS-PAGE and HPLC.
17.1 kDa
E.Coli
100 μg, 500 μg - Item 1 of 1
Human IL1RA Protein, hFc Tag [orb1173740]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 62.3 kDa after removal of the signal peptide.The apparent molecular mass of IL1RA-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human IL1RA Protein, His Tag [orb2321377]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 37.5 kDa after removal of the signal peptide. The apparent molecular mass of IL1RA-His is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human IL1RA Protein, mFc Tag [orb2321379]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 62.4 kDa after removal of the signal peptide. The apparent molecular mass of IL1RA-mFc is approximately 70-100 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
