Cart summary

You have no items in your shopping cart.

    Human IL17B protein (Active)

    Catalog Number: orb358964

    DispatchUsually dispatched within 1-2 weeks
    $ 2,546.00
    Catalog Numberorb358964
    CategoryProteins
    DescriptionRecombinant human IL17B active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 95% as determined by SDS-PAGE and HPLC.
    MW18.3 kDa
    UniProt IDQ9UHF5
    Protein SequenceM+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
    Protein LengthFull Length of Mature Protein
    SourceE.Coli
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
    Expression Region21-180aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose
    Alternative namesIL-17B, Interleukin-20, IL-20, Neuronal interleuki
    Read more...
    BackgroundStimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Human IL17B protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars