You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL17A protein
Catalog Number: orb594787
| Catalog Number | orb594787 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-17A(IL17A) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.26 kDa |
| UniProt ID | Q16552 |
| Protein Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 1-7 ng/ml. |
| Expression Region | 24-155aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4 |
| Alternative names | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lympho Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human IL17A Protein [orb1476713]
Greater than 95% as determined by SDS-PAGE.
15.9 kDa
Baculovirus
100 μg, 20 μg, 1 mg - Item 1 of 1
Human IL17A protein [orb594788]
Greater than 95% as determined by SDS-PAGE.
15.9kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL17A Protein, hFc Tag [orb1291066]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.3 kDa after removal of the signal peptide.The apparent molecular mass of IL17A-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
- Item 1 of 1
