You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human IL17A Protein
Catalog Number: orb1476713
| Catalog Number | orb1476713 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-17A(IL17A)(T26A) (Active) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.9 kDa |
| UniProt ID | Q16552 |
| Protein Sequence | GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Protein Length | Full Length of Mature Protein |
| Source | Baculovirus |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 μg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL. |
| Expression Region | 24-155aa(T26A) |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL17A protein [orb594787]
Greater than 95% as determined by SDS-PAGE.
15.26 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL17A protein [orb594788]
Greater than 95% as determined by SDS-PAGE.
15.9kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL17A Protein, hFc Tag [orb1291066]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.3 kDa after removal of the signal peptide.The apparent molecular mass of IL17A-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human IL17A Protein [orb1477795]
Greater than 85% as determined by SDS-PAGE.
44.0 kDa
E.coli
20 μg, 100 μg, 1 mgHuman IL17A & IL17F protein [orb594824]
Greater than 95% as determined by SDS-PAGE.
15.1kDa & 16.0 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg
