You have no items in your shopping cart.
Cart summary
Human IL17A & IL17F protein
Catalog Number: orb594824
| Catalog Number | orb594824 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-17A & Interleukin-17F(IL17A & IL17F) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.1kDa & 16.0 kDa |
| UniProt ID | Q16552 |
| Protein Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ |
| Protein Length | Heterodimer |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay. ②Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay. |
| Expression Region | 24-155aa & 31-163aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | IL‑17A/F Heterodimer;IL-17A&IL-17F Heterodimer Read more... |
| Note | For research use only |
| Application notes | Heterodimer |
| Expiration Date | 6 months from date of receipt. |
