You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL15 protein
Catalog Number: orb594793
| Catalog Number | orb594793 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-15(IL15) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 12.5 kDa |
| UniProt ID | P40933 |
| Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml. |
| Expression Region | 49-162aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0 |
| Alternative names | Interleukin-15; IL-15; IL15 Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL15 protein (Active) [orb358961]
> 97% as determined by SDS-PAGE and HPLC.
12.9 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 3
Human IL15 Protein, hFc Tag [orb1291067]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.9 kDa after removal of the signal peptide. The apparent molecular mass of IL15-hFc is approximately 35-55kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 3
- Item 1 of 3
- Item 1 of 3
