You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL13 protein
Catalog Number: orb594786
| Catalog Number | orb594786 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-13(IL13),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 13.4 kDa |
| UniProt ID | AAH96139 |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml. |
| Expression Region | 25-146aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. |
| Alternative names | Interleukin-13;IL-13; Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL-13 Protein, His Tag [orb612135]
Unconjugated
90%
14.2 kDa
Human IL-13, His Tag (orb612135) is expressed from human 293 cells (HEK293). It contains AA Gly 21 - Asn 132 (Accession # AAK53823.1).
50 μg, 500 μg - Item 1 of 1
Human IL-13 Protein, Fc Tag [orb612113]
Unconjugated
90%
38.8 kDa
Human IL-13, Fc Tag (orb612113) is expressed from human 293 cells (HEK293). It contains AA Gly 21 - Asn 132 (Accession # AAK53823.1).
500 μg, 50 μg - Item 1 of 1
Canine IL-13 Protein, His Tag [orb864195]
Unconjugated
90%
14.3 kDa
Canine IL-13, His Tag (orb864195) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Arg 131 (Accession # NP_001003384.1).
50 μg, 500 μg
