Cart summary

You have no items in your shopping cart.

Human IL12A protein

Catalog Number: orb419321

DispatchUsually dispatched within 1-2 weeks
$ 400.00
Catalog Numberorb419321
CategoryProteins
DescriptionRecombinant Human Interleukin-12 subunit alpha active
TagTag-Free
Form/AppearanceLyophilized powder
Purity> 95% as determined by SDS-PAGE and HPLC.
MW57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
UniProt IDP29459
Protein Sequencep35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Protein LengthFull Length of Mature Protein
SourceBaculovirus
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
Expression Region23-219aa&23-328aa
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Alternative namesIL-12A, CLMF p35, IL-12 subunit p35, NK cell stimu
Read more...
NoteFor research use only
Application notesTag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial
Expiration Date6 months from date of receipt.
Human IL12A protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Human IL-12A Protein, Fc Tag [orb257707]

    Unconjugated

    90%

    49.2 kDa

    Human IL-12A, Fc Tag (orb257707) is expressed from human 293 cells (HEK293). It contains AA Arg 23 - Ser 219 (Accession # P29459).

    50 μg, 500 μg
  • Human Active Protein [orb1476717]

    Greater than 95% as determined by SDS-PAGE.

    39.7 kDa & 27.2 kDa

    Mammalian cell

    1 mg, 20 μg, 100 μg
  • IL12A (Human) Recombinant Protein (Q01) [orb2288367]

    AP,  Array,  ELISA,  WB

    10 μg
  • Human IL-12 Protein [orb1471767]

    Greater than 95% as determined by reducing SDS-PAGE.

    22.5and34.7 KDa

    Mammalian

    10 μg, 50 μg
  • Human IL12A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743293]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide.

    Mammalian

    50 μg, 10 μg, 100 μg