You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL12A protein
Catalog Number: orb419321
| Catalog Number | orb419321 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-12 subunit alpha active |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| MW | 57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value. |
| UniProt ID | P29459 |
| Protein Sequence | p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein Length | Full Length of Mature Protein |
| Source | Baculovirus |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of ＞ 2.0 × 107 IU/mg. |
| Expression Region | 23-219aa&23-328aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Alternative names | IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimu Read more... |
| Note | For research use only |
| Application notes | Tag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human IL-12A / NKSF1 / p35 Protein [orb257707]
Unconjugated
90%
49.2 kDa
Human IL-12A, Fc Tag (orb257707) is expressed from human 293 cells (HEK293). It contains AA Arg 23 - Ser 219 (Accession # P29459).
50 μg, 500 μg - Item 1 of 1
- Item 1 of 2
Recombinant human IL-12 protein, C-His-Avi (HEK293) [orb1516422]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 45/40 kDa based on Tris-Bis PAGE result. kDa
50 μg - Item 1 of 1
Human IL-12 Protein [orb1471767]
Greater than 95% as determined by reducing SDS-PAGE.
22.5and34.7 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human IL12A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743293]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μg
