Cart summary

You have no items in your shopping cart.

    Human IL11 protein (Active)

    Catalog Number: orb358976

    DispatchUsually dispatched within 1-2 weeks
    $ 4,390.00
    Catalog Numberorb358976
    CategoryProteins
    DescriptionRecombinant human IL11 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 95% as determined by SDS-PAGE and HPLC.
    MW19.1 kDa
    UniProt IDP20809
    Protein SequenceM+PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
    Protein LengthFull Length of Mature Protein
    SourceE.Coli
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine B9-11 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 106 IU/mg.
    Expression Region22-199aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
    Alternative namesIL-11, AGIF, Oprelvekin
    Read more...
    BackgroundCytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:2145578). Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation (PubMed:12919066). Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. {ECO:0000250|UniProtKB:P47873, ECO:0000269|PubMed:12919066, ECO:0000269|PubMed:2145578}.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Human IL11 protein (Active)

    SDS-PAGE analysis of Human IL11 protein (Active)

    Human IL11 protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars