Human IL1 alpha protein

• Catalog Number: orb80048
• Category: Proteins
• Description: Human IL1 alpha protein
• Tested applications: FA, HPLC, SDS-PAGE
• Purity: > 98.0% as determined by RP-HPLC and analysis by SDS-PAGE
• Conjugation: Unconjugated
• Target: Human IL1 alpha
• Solubility (25°C): It is recommended to reconstitute the lyophilized Interleukin alpha in sterile H₂O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
• Biological Origin: E.coli
• Biological Activity: The ED50 as determined by the dose-dependant stimulation of murine D10S cells is 0.001 ng/ml, corresponding to Specific Activity of x 1,000,000,000 IU/mg.
• Storage: Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
• Buffer/Preservatives: The protein was lyophilized from concentrated (1mg/ml) sterile solution containing 20 mM Tris-HCL, pH=8, 5mM MgCl2 and 10% glycerol.
• Alternative names: Hematopoietin 1 protein, Hematopoietin-1 protein,
• Note: For research use only
• Application notes: Experiment Notes: Protein quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 1.13 as the extinction coefficient for 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using standard solution of IL-1 as Reference Standard.
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human IL1 alpha protein