You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL1 alpha protein
Catalog Number: orb604187
| Catalog Number | orb604187 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-1 alpha(IL1A) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 22 kDa |
| UniProt ID | P01583 |
| Protein Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 113-271aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Hematopoietin-1 Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL1 alpha protein (Active) [orb358965]
> 97% as determined by SDS-PAGE and HPLC.
18.0 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL1 Receptor protein [orb419249]
Greater than 85% as determined by SDS-PAGE.
83.5 kDa
in vitro E.coli expression system
100 μg, 20 μg - Item 1 of 1
Human IL1 alpha protein [orb604188]
Greater than 90% as determined by SDS-PAGE.
45 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Recombinant human IL-1 Alpha protein, His (HEK293) [orb1516668]
> 95% as determined by SDS-PAGE
25 kDa
500 μg, 100 μg - Item 1 of 1
Human IL1A Protein, hFc Tag [orb1173724]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.2 kDa after removal of the signal peptide.The apparent molecular mass of IL1A-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg
