Human IL-8 protein

Catalog Number: orb1216265

Catalog Number	orb1216265
Category	Proteins
Description	The Human IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Human IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-8 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: EGAVLPRSAK ELRCQCIKTY SKPFHPKFIK ELRVIESGPH CANTEIIVKL SDGRELCLDP KENWVQRVVE KFLKRAENS (79)) (Gene ID: 3576).
Form/Appearance	Lyophilized
Purity	98%
MW	9.1 kDa
Target	IL-8
Entrez	3576
Protein Sequence	EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS (79)
Protein Length	79
Source	Yeast
Storage	-20°C
Alternative names	CXCL8 Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	8.4 kDa
Source:	E.Coli

Purity:	> 96% as determined by SDS-PAGE and HPLC.
MW:	8.9 kDa
Source:	E.Coli

Conjugation:	Unconjugated
Purity:	95%
MW:	11.0 kDa
Source:	Cynomolgus IL-8, His Tag (orb1496280) is expressed from human 293 cells (HEK293). It contains AA Ala 23 - Pro 101 (Accession # A0A2K5TUL7-1).