You have no items in your shopping cart.
Cart summary
Human IL-23 protein
Catalog Number: orb594820
| Catalog Number | orb594820 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-23(IL-23) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 54.4 kDa |
| UniProt ID | Q9NPF7, P29460 |
| Protein Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein Length | Heterodimer |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 70-210 ng/ml. |
| Expression Region | 20-189aa & 23-328aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2 Read more... |
| Note | For research use only |
| Application notes | Heterodimer |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Mouse IL-23 R Protein [orb383506]
Unconjugated
90%
66.8 kDa
Mouse IL-23R, Fc Tag (orb383506) is expressed from human 293 cells (HEK293). It contains AA Gly 24 - Asp 372 (Accession # Q8K4B4-1).
1 mg, 100 μg - Item 1 of 1
Human IL-23 R Protein [orb570284]
Unconjugated
95%
64.5 kDa
Human IL-23 R, Fc Tag (orb570284) is expressed from human 293 cells (HEK293). It contains AA Gly 24 - Gly 355 (Accession # Q5VWK5-1).
100 μg, 1 mg - Item 1 of 1
Human IL-23 R Protein [orb570286]
Unconjugated
90%
39.9 kDa
Human IL-23 R, His Tag (orb570286) is expressed from human 293 cells (HEK293). It contains AA Gly 24 - Gly 355 (Accession # Q5VWK5-1).
100 μg, 1 mg Human IL23R Protein, His Tag [orb1743305]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 37.4 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman IL23A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743335]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.8 and 35.5 kDa after removal of the signal peptide. The apparent molecular mass of IL23A-hFc and IL12B-His is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
