Human IL-13 Recombinant Protein

Catalog Number: orb1820056

Catalog Number	orb1820056
Category	Proteins
Description	The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596).
Form/Appearance	Lyophilized
Purity	98%
MW	12.3 kDa
Target	IL-13
Entrez	3596
Protein Sequence	GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)
Protein Length	112
Source	Yeast
Storage	-20°C
Note	For research use only
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 38.1 kDa after removal of the signal peptide. The apparent molecular mass of IL13-hFc is approximately 35-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	12.3 kDa
Source:	E.Coli

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	12.5 kDa
Source:	E.Coli

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	13.4 kDa
Source:	Mammalian cell

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells