You have no items in your shopping cart.
Cart summary
Human IL-13 protein
Catalog Number: orb1215950
| Catalog Number | orb1215950 |
|---|---|
| Category | Proteins |
| Description | The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 12.3 kDa |
| Target | IL-13 |
| Entrez | 3596 |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) |
| Protein Length | 112 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 7
Human IL-13 R alpha 2 Protein [orb612134]
Unconjugated
90%
39.0 kDa
Human IL-13 R alpha 2, His Tag (orb612134) is expressed from human 293 cells (HEK293). It contains AA Asp 27 - Arg 343 (Accession # Q14627-1).
100 μg, 1 mg - Item 1 of 2
Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Human IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Human IL-13 R alpha 1 Protein [orb257580]
Unconjugated
90%
37.7 kDa
Human IL-13 R alpha 1 Protein, His Tag (orb257580) is expressed from human 293 cells (HEK293). It contains AA Gly 22 - Thr 343 (Accession # NP_001551.1).
1 mg, 100 μg - Item 1 of 2
Mouse IL-13 R alpha 1 Protein [orb257586]
Unconjugated
95%
62.7 kDa
Mouse IL-13RA1, Fc Tag (orb257586) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Thr 340 (Accession # NP_598751).
1 mg, 200 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
