Cart summary

You have no items in your shopping cart.

    Human IHH protein (Active)

    Catalog Number: orb359262

    DispatchUsually dispatched within 1-2 weeks
    $ 3,048.00
    Catalog Numberorb359262
    CategoryProteins
    DescriptionRecombinant human IHH active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 96% as determined by SDS-PAGE and HPLC.
    MW19.8 kDa
    UniProt IDQ14623
    Protein SequenceII+GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
    Protein LengthPartial
    SourceE.Coli
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.
    Expression Region29-202aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 μm filtered 1 × PBS, pH 7.4
    Alternative namesIHH,
    Read more...
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Human IHH protein (Active)

    SDS-PAGE analysis of Human IHH protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars