You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594773 |
---|---|
Category | Proteins |
Description | Recombinant Human Interferon alpha-2(IFNA2) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 19.4 kDa |
UniProt ID | P01563 |
Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL. |
Expression Region | 24-188aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Alternative names | Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha- Read more... |
Background | At least 23 different variants of IFN-α are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes differ in their sequences by only one or two positions. Naturally occurring variants also include proteins that are truncated by 10 amino acids at the carboxyl-terminal e |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
19.2 kDa | |
Yeast |
> 96% as determined by SDS-PAGE and HPLC. | |
19.4 kDa | |
E.Coli |
> 98% as determined by SDS-PAGE and HPLC. | |
19.3 kDa | |
Yeast |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. | |
E. coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. | |
E. coli |
Filter by Rating