Cart summary

You have no items in your shopping cart.

Human IFNA1 protein (Active)

Catalog Number: orb359209

DispatchUsually dispatched within 1-2 weeks
$ 400.00
Catalog Numberorb359209
CategoryProteins
DescriptionRecombinant human IFNA1 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Purity> 96% as determined by SDS-PAGE and HPLC.
MW19.5 kDa
UniProt IDP01562
Protein SequenceM+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Protein LengthFull Length of Mature Protein
SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 × 108 IU/mg.
Expression Region24-189aa
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, containing 4 % mannitol and 1 % HSA
Alternative namesIFN-alpha-1/13, LeIF D
Read more...
NoteFor research use only
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
Human IFNA1 protein (Active)