You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820795 |
---|---|
Category | Proteins |
Description | The Human IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Human IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Human IFN gamma Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: QDPYVKEAEN LKKYFNAGHS DVADNGTLFL GILKNWKEES DRKIMQSQIV SFYFKLFKNF KDDQSIQKSV ETIKEDMNVK FFNSNKKKRD DFEKLTNYSV TDLNVQRKAI HELIQVMAEL SPAAKTGKRK RSQMLFRGRR ASQ (143)) (Gene ID: 3458). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.8 kDa |
Target | IFN gamma |
Entrez | 3458 |
Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ (143) |
Protein Length | 143 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
16.88 kDa | |
E.coli |
Filter by Rating