You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594774 |
---|---|
Category | Proteins |
Description | Recombinant Human Interferon gamma(IFNG) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 16.88 kDa |
UniProt ID | P01579 |
Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by a viral resistance assay using HT-29 cells is 17 pg/mL. |
Expression Region | 24-166aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 250mM NaCl, pH 8.5. |
Alternative names | Interferon Gamma; IFN-Gamma; Immune Interferon; IF Read more... |
Background | IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2, FGF-basic, and EG |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 98% as determined by SDS-PAGE and HPLC. | |
16.9 kDa | |
E.Coli |
Unconjugated | |
95% | |
26.6 kDa | |
Human IFN-gamma R1, His Tag (orb257557) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333). |
Unconjugated | |
95% | |
52.4 kDa | |
Human IFN-gamma R1, Fc Tag (orb257559) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333). |
Unconjugated | |
95% | |
16.8 kDa | |
Human IFN-gamma, premium grade (orb257562) is expressed from human 293 cells (HEK293). It contains AA Gln 24 - Gln 166 (Accession # AAH70256). |
Unconjugated | |
90% | |
17.4 kDa | |
Mouse IFN-gamma Protein, His Tag (orb1496306) is expressed from human 293 cells (HEK293). It contains AA His 23 - Cys 155 (Accession # P01580). |
Filter by Rating