You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IFN gamma protein
Catalog Number: orb594774
| Catalog Number | orb594774 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interferon gamma(IFNG) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 16.88 kDa |
| UniProt ID | P01579 |
| Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by a cytotoxicity assay using HT-29 cells is 17 pg/ml. |
| Expression Region | 24-166aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5. |
| Alternative names | Interferon Gamma; IFN-Gamma; Immune Interferon; IF Read more... |
| Background | IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2, FGF-basic, and EG |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IFN gamma protein (Active) [orb359214]
> 98% as determined by SDS-PAGE and HPLC.
16.9 kDa
E.Coli
500 μg, 100 μg - Item 1 of 2
Human IFN-gamma R1 / IFNGR1 Protein [orb257557]
Unconjugated
95%
26.6 kDa
Human IFN-gamma R1, His Tag (orb257557) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333).
1 mg, 200 μg - Item 1 of 2
Human IFN-gamma R1 / IFNGR1 Protein [orb257559]
Unconjugated
95%
52.4 kDa
Human IFN-gamma R1, Fc Tag (orb257559) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333).
1 mg, 200 μg - Item 1 of 2
Human IFN-gamma / IFNG Protein [orb257562]
Unconjugated
95%
16.8 kDa
Human IFN-gamma, premium grade (orb257562) is expressed from human 293 cells (HEK293). It contains AA Gln 24 - Gln 166 (Accession # AAH70256).
1 mg, 20 μg, 100 μg - Item 1 of 2
Human IFNGR1 Protein, hFc Tag [orb1291003]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.9 kDa after removal of the signal peptide. The apparent molecular mass of IFNGR1-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg
