You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216300 |
---|---|
Category | Proteins |
Description | The Human IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Human IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Human IFN gamma Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: QDPYVKEAEN LKKYFNAGHS DVADNGTLFL GILKNWKEES DRKIMQSQIV SFYFKLFKNF KDDQSIQKSV ETIKEDMNVK FFNSNKKKRD DFEKLTNYSV TDLNVQRKAI HELIQVMAEL SPAAKTGKRK RSQMLFRGRR ASQ (143)) (Gene ID: 3458). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.8 kDa |
Target | IFN gamma |
Entrez | 3458 |
Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ (143) |
Protein Length | 143 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 98% as determined by SDS-PAGE and HPLC. | |
16.9 kDa | |
E.Coli |
Unconjugated | |
95% | |
16.8 kDa | |
Human IFN-gamma, premium grade (orb257562) is expressed from human 293 cells (HEK293). It contains AA Gln 24 - Gln 166 (Accession # AAH70256). |
Unconjugated | |
95% | |
26.6 kDa | |
Human IFN-gamma R1, His Tag (orb257557) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333). |
Unconjugated | |
95% | |
52.4 kDa | |
Human IFN-gamma R1, Fc Tag (orb257559) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333). |
Greater than 95% as determined by SDS-PAGE. | |
16.88 kDa | |
E.coli |
Filter by Rating