Human I36RA protein (Active)

• Catalog Number: orb358996
• Category: Proteins
• Description: Recombinant human I36RA active protein
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• MW: 16.8 kDa
• UniProt ID: Q9UBH0
• Protein Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-36 beta induced IL-8 secretion by human preadipocytes is less than 1.0 μg/ml, corresponding to a specific activity of ＞ 1000 IU/mg in the presence of 20 ng/ml of recombinant human IL-36 beta.
• Expression Region: 2-155aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Alternative names: IL-36Ra, IL-1-related protein 3, IL-1RP3, Interleu
• Background: Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. {ECO:0000269|PubMed:11466363, ECO:0000269|PubMed:21965679, ECO:0000269|PubMed:23147407}.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human I36RA protein (Active)