You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494958 |
---|---|
Category | Proteins |
Description | CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-γ and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T-cells, neutrophils or monocytes. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Source | Escherichia coli. |
Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg. |
Endotoxins | Less than 1EU/mg of rHuI-TAC/CXCL11 as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating