Human GYPA protein

Catalog Number: orb604144

Catalog Number	orb604144
Category	Proteins
Description	Recombinant Human Glycophorin-A(GYPA),partial
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	12 kDa
UniProt ID	A0A0C4DFT7
Protein Sequence	LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Protein Length	Partial
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	20-91aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	MN sialoglycoprotein, PAS-2Sialoglycoprotein alpha Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 33.3 kDa after removal of the signal peptide. The apparent molecular mass of CD235A-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	9.9 kDa
Source:	Yeast

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	34.9 kDa
Source:	E.coli

Conjugation:	Unconjugated
Purity:	95%
MW:	39.1 kDa
Source:	Mouse Glycophorin A, Fc,His Tag (orb257312) is expressed from human 293 cells (HEK293). It contains AA Met 1 - Val 108 (Accession # P14220).