Human GLP1R protein

Catalog Number: orb383448

Catalog Number	orb383448
Category	Proteins
Description	Recombinant human GLP1R protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	18.3 kDa
UniProt ID	P43220
Protein Sequence	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Expression Region	24-145aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	GLP-1 receptor Short name, GLP-1-R Short name, GLP Read more...
Note	For research use only
Application notes	Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of GLP1R-hFc is approximately 35-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

MW:	The human full length GLP1R protein has a MW of 53.0 kDa
Source:	Mammalian

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	19.3 kDa
Source:	Mammalian cell

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	16.3 kDa
Source:	Yeast