You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495055 |
---|---|
Category | Proteins |
Description | GMF-β, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids. |
Protein Sequence | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH |
Source | Escherichia coli. |
Biological Activity | Data Not Available. |
Endotoxins | Less than 1EU/g of rHuGMF-b as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating