You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605091 |
---|---|
Category | Proteins |
Description | Recombinant Human Growth/differentiation factor 15(GDF15),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 16.2 kDa |
UniProt ID | Q99988 |
Protein Sequence | RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 198-308aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Macrophage inhibitory cytokine 1 , MIC-1NSAID-acti Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Biotin | |
90% | |
40.4 kDa | |
Biotinylated Human GDF-15, , Fc Tag (orb1184782) is expressed from human 293 cells (HEK293). It contains AA Ala 197 - Ile 308 (Accession # Q99988-1). |
Unconjugated | |
95% | |
38.8 kDa | |
Human GDF-15, Fc Tag (orb1087553) is expressed from human 293 cells (HEK293). It contains AA Ala 197 - Ile 308 (Accession # Q99988-1). |
Unconjugated | |
90% | |
14.2 kDa | |
Human GDF-15, His Tag (orb624215) is expressed from E. coli cells. It contains AA Ala 197 - Ile 308 (Accession # Q99988-1). |
Filter by Rating