You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215809 |
---|---|
Category | Proteins |
Description | The Human Frizzled-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human Frizzled-1 applications are for cell culture, ELISA standard, and Western Blot Control. Human Frizzled-1 yeast-derived recombinant protein can be purchased in multiple sizes. Human Frizzled-1 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178)) (Gene ID: 8321). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.4 kDa |
Target | Frizzled-1 |
Entrez | 8321 |
Protein Sequence | QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178) |
Protein Length | 178 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
The human full length FZD1 protein has a MW of 71.2kDa | |
Mammalian |
> 92% by SDS-PAGE. | |
KMP1398, Recombinant Human Frizzled-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln73-His Tag253) of human Frizzled-1 (Accession #NP_003496.1) fused with an Fc, 6×His Tag at the C-terminus. |
Filter by Rating