You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594929 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibronectin(FN1),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 62.7 kDa |
UniProt ID | P02751 |
Protein Sequence | PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS&AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
Protein Length | Dimer |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1×10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100μL/well),approximately 50%-80% will adhere specifically after 30 minutes at 37℃. |
Expression Region | 1270-1546aa & 1721-2016aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2 |
Alternative names | NovoNectin;Fibronectin; FN; Cold-insoluble globuli Read more... |
Note | For research use only |
Application notes | Dimer |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 270.1 kDa after removal of the signal peptide. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Greater than 90% as determined by SDS-PAGE. | |
23.6 kDa | |
E.coli |
Filter by Rating