You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54116 |
---|---|
Category | Proteins |
Description | Recombinant human FGFR3 protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 47.4 kDa |
UniProt ID | P22607 |
Protein Sequence | RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT |
Protein Length | Partial |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 397-806aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CD_antigen, CD333 Read more... |
Note | For research use only |
Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-429AA: 397-806AAFull Length: Partial |
Expiration Date | 6 months from date of receipt. |
Functional Studies, IA, WB | |
> 95% | |
39.7 | |
HEK293 cells |
Functional Studies, IA, WB | |
> 95% | |
41.2 | |
HEK293 cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Human | |
62.5 pg/mL-4000 pg/mL | |
15.6 pg/mL |
Filter by Rating