You have no items in your shopping cart.
Cart summary
Human FGF1 protein
Catalog Number: orb594730
| Catalog Number | orb594730 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fibroblast growth factor 1(FGF1) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.9 kDa |
| UniProt ID | P05230 |
| Protein Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.2-2 ng/ml. |
| Expression Region | 16-155aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0 |
| Alternative names | Fibroblast Growth Factor 1; FGF-1; Acidic Fibrobla Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
FGF1 purified MaxPab mouse polyclonal antibody (B01P) [orb2293066]
IF, WB
Human
Mouse
Polyclonal
Unconjugated
50 μg - Item 1 of 1
Human FGF1 protein [orb419317]
> 97% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human FGF1 protein (Active) [orb359150]
> 95% as determined by SDS-PAGE and HPLC.
16.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
- Item 1 of 1
