Human FGF1 protein

• Catalog Number: orb419317
• Category: Proteins
• Description: Recombinant Human Fibroblast growth factor 1 active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• MW: 17.5 kDa
• UniProt ID: P05230
• Protein Sequence: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106 IU/mg in the presence of 10 μg/ml of heparin.
• Expression Region: 1-155aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose
• Alternative names: FGF-1, aFGF, Endothelial cell growth factor, ECGF,
• Note: For research use only
• Application notes: Tag Info: NO-taggedExpression Region: 1-155aaSequence Info: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human FGF1 protein