You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FGF1 protein (Active)
Catalog Number: orb359150
| Catalog Number | orb359150 |
|---|---|
| Category | Proteins |
| Description | Recombinant human FGF1 active protein |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| MW | 16.0 kDa |
| UniProt ID | P05230 |
| Protein Sequence | M+FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Protein Length | Full Length of Mature Protein |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106 IU/mg in the presence of 10 μg/ml of heparin. |
| Expression Region | 16-155aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Alternative names | FGF-1, aFGF, Endothelial cell growth factor, ECGF, Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human FGF1 protein (Active)
- Item 1 of 1
Human FGF1 protein [orb419317]
> 97% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Human FGF1 protein [orb594730]
Greater than 95% as determined by SDS-PAGE.
15.9 kDa
E.coli
500 μg, 1 mg, 50 μg, 10 μgRecombinant Human Fibroblast growth factor 1 protein(FGF1) (Active) [orb1650718]
50 μg, 100 μg, 1 mg, 10 μg, 250 μg, 500 μgRecombinant Human Fibroblast growth factor 1 protein(FGF1) (Active) [orb1650719]
50 μg, 100 μg, 1 mg, 10 μg, 250 μg, 500 μgRecombinantFGF-acidic,Human [orb1494870]
> 95% by SDS-PAGE and HPLC analyses.
15.8 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
50 μg, 10 μg, 1 mg
