You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246924 |
---|---|
Category | Proteins |
Description | Human FCGRT protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34.4 kDa |
UniProt ID | P55899 |
Protein Sequence | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Expression Region | 24-297aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Alpha chain protein, Fc fragment of IgG, receptor Read more... |
Note | For research use only |
Application notes | Full length of the Extracellular domain of HIS and expression region is 24-297aa |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Greater than 90% as determined by SDS-PAGE. | |
32.4 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
57.4 kDa | |
E.coli |
> 97% by SDS-PAGE. | |
KMP1768, Recombinant Human FCGRT&B2M Protein is produced by HEK293 Cells expression system. The target heterodimer proteins are co-expressed with the sequence (Ala24-Ser297) of human FCGRT (Accession #NP_004098.1) fused with a 6×His Tag at the C-terminus and the sequence (Ile21-Met119) of human B2M (Accession #NP_004039.1). |
≥90% as determined by SDS-PAGE | |
This protein contains the human FCGRT(Ala24-Leu290&Ile21-Met119) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating