You have no items in your shopping cart.
Cart summary
Human FCGR3A protein
Catalog Number: orb594865
| Catalog Number | orb594865 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 22.61 kDa |
| UniProt ID | P08637 |
| Protein Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml. |
| Expression Region | 17-208aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Alternative names | Low Affinity Immunoglobulin Gamma Fc Region Recept Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
Human FCGR3B Protein, His Tag [orb1743278]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 21.6 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman FCGR3B Protein, hFc Tag [orb1743281]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.9 kDa after removal of the signal peptide. The apparent molecular mass of FCGR3B-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman FCGR3A protein [orb706845]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman FCGR3A Protein [orb1477110]
Greater than 85% as determined by SDS-PAGE.
50.7 kDa
E.coli
20 μg, 100 μg, 1 mgHuman FCGR3A protein [orb391714]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
50 μg, 500 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
