Human FCER2 protein

Catalog Number: orb244202

Catalog Number	orb244202
Category	Proteins
Description	Recombinant human Low affinity immunoglobulin epsilon Fc receptor
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	47 kDa
UniProt ID	P06734
Protein Sequence	DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Protein Length	Extracellular Domain
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	48-321aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	FCER2 Read more...
Note	For research use only
Application notes	Full length of Extracellular of His-SUMO-tag and expression region is 48-321aa
Expiration Date	6 months from date of receipt.

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	27.3 kDa
Source:	E.coli

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	49.9 kDa
Source:	E.coli

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	33.2 kDa
Source:	Mammalian cell

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human FCER2(Asp48-Ser321) was fused with the N-terminal His Tag and expressed in Mammalian cells.