You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494985 |
---|---|
Category | Proteins |
Description | Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
Protein Sequence | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Source | Escherichia coli. |
Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg. |
Endotoxins | Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating