Human EGF protein

• Catalog Number: orb594725
• Category: Proteins
• Description: Recombinant Human Pro-epidermal growth factor(EGF),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 6.2 kDa
• UniProt ID: P01133
• Protein Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Protein Length: Partial
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by the dose-dependent proliferation of murine BALB/c 3T3 cells is typically 0.1-0.5 ng/ml
• Expression Region: 971-1023aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0
• Alternative names: Pro-Epidermal Growth Factor; EGF; Epidermal Growth
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.