Human EFNA4 protein

Catalog Number: orb594900

Catalog Number	orb594900
Category	Proteins
Description	Recombinant Human Ephrin-A4(EFNA4),partial (Active)
Tag	C-terminal 6xHis-Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	44.3 kDa
UniProt ID	P52798
Protein Sequence	LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to bind Human EphA7 in functional ELISA is less than 10 ug/ml.
Expression Region	26-171aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered PBS, pH 7.4.
Alternative names	Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Li Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	> 80% by SDS-PAGE.
Source:	KMP1145, Recombinant Human Ephrin-A4/EFNA4 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Leu26-Gly171) of human Ephrin-A4/EFNA4 (Accession # NP_005218.1) fused with an Fc, 6×His Tag at the C-terminus.

Sizes Available: 100 μg, 50 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Conjugation:	Unconjugated
Purity:	95%
MW:	17.5 kDa
Source:	Human Ephrin-A4, His Tag (orb257408) is expressed from human 293 cells (HEK293). It contains AA Leu 26 - Gly 171 (Accession # AAI07484).